Beefy Boxes and Bandwidth Generously Provided by pair Networks
We don't bite newbies here... much
 
PerlMonks  

Re: PROTEIN FILE help me pleaseee

by 2teez (Priest)
on Jan 30, 2013 at 14:58 UTC ( #1016073=note: print w/ replies, xml ) Need Help??


in reply to PROTEIN FILE help me pleaseee

Hi serafinososi,

...If the line starts with > (it is the first line of a FASTA file) the line is not considered...

What if the line that starts with ">" is more than one in the file what happens?

If I understand the OP's question, using the data provided, if I may suggest (adding to what others have said) using perl function split may do like so:

use warnings; use strict; my $protein; while (<DATA>) { if (/^>/) { next; } else { $protein = join '', split; } } my $number_of_F = grep { /F/ } split //, $protein; print "The aminoacid sequence: ", $protein, " contains ", $number_of_F +, " Phenylalanine aminoacids", $/; __DATA__ >gi|403369491|gb|EJY84591.1| Transcriptional regulator, Sir2 family pr +otein Oxytricha trifallax MMKQLIKHNKNTPLFNFLRVKFSSTAATIQTQQTVNKPIESKFKEEKLDNYHDIYEKSKRLAEQISQSKS + FICFTGAGLSTSTGIPDYRSTSNTLAQTGAGAYELEISEEDKKSKTRQIRSQVQRAKPSISHMALHAL +ME NGYLKHLISQNTDGLHLKSGIPYQNLTELHGNTTVEYCKSCSKIYFRDFRCRSSEDPYHHLTGRQC +EDLK CGGELADEIVHFGESIPKDKLVEALTAASQSDLCLTMGTSLRVKPANQIPIQTIKNKGQLAIVN +LQYTPF DEIAQIRMHSFTDQVLEIVCQELNIKIPEYQMKRRIHIIRNAETNEIVVYGSYGNHKNIKLS +FMQRMEYI DNKNHVYLALDKEPFHIIPDYFNFQNINTDQEEVEFRIHFYGHNSEPYFQLTLPRQSILE +LQAGEHLICD ITFDYDKLEWK

If you tell me, I'll forget.
If you show me, I'll remember.
if you involve me, I'll understand.
--- Author unknown to me


Comment on Re: PROTEIN FILE help me pleaseee
Download Code

Log In?
Username:
Password:

What's my password?
Create A New User
Node Status?
node history
Node Type: note [id://1016073]
help
Chatterbox?
and the web crawler heard nothing...

How do I use this? | Other CB clients
Other Users?
Others taking refuge in the Monastery: (17)
As of 2015-07-28 18:55 GMT
Sections?
Information?
Find Nodes?
Leftovers?
    Voting Booth?

    The top three priorities of my open tasks are (in descending order of likelihood to be worked on) ...









    Results (258 votes), past polls