Problems? Is your data what you think it is? | |
PerlMonks |
file header changeby utpalmtbi (Acolyte) |
on Feb 05, 2013 at 09:38 UTC ( [id://1017091]=perlquestion: print w/replies, xml ) | Need Help?? |
utpalmtbi has asked for the wisdom of the Perl Monks concerning the following question:
Hello, Perl Monks;
I have a multi fasta file (with header > and sequence) in the following format: >contig_1 # 498 # 1826 # 1 # ID=1_1;partial=00;start_type=ATG;rbs_motif=AGxAGG/AGGxGG;rbs_spacer=5-10bp;gc_cont=0.406 MNLTFDYTKEPSRDVLCIDVKSFYASVECVERG LDPLKTMLVVMSNSENSGGLVLAASPM >contig_2 # 1823 # 2173 # 1 # ID=1_2;partial=00;start_type=ATG;rbs_motif=GGA/GAG/AGG;rbs_spacer=5-10bp;gc_cont=0.311 MKQNRKEFSSYFSRSIKQNKPLYLLLMSSETNPF PRPVIGTFRGYVEENKIIIGEDSYSI .... ...and i want to edit the header lines as just a simple number count: >1 MNLTFDYTKEPSRDVLCIDVKSFYASVECVERG LDPLKTMLVVMSNSENSGGLVLAASPM >2 MKQNRKEFSSYFSRSIKQNKPLYLLLMSSETNPF PRPVIGTFRGYVEENKIIIGEDSYSI .... ... may be it's a too simple questions, but I only started to learn perl and got stuck.. thanks in advance..
Back to
Seekers of Perl Wisdom
|
|