Beefy Boxes and Bandwidth Generously Provided by pair Networks
Syntactic Confectionery Delight
 
PerlMonks  

rename FASTA

by naka (Initiate)
on Sep 19, 2012 at 14:39 UTC ( #994470=perlquestion: print w/ replies, xml ) Need Help??
naka has asked for the wisdom of the Perl Monks concerning the following question:

Hello,

I have never made a script in my life. The ploblem is how to change the fasta names like this input file:

>Glyma04g14800|Glyma04g14800.3

MMLETVAAVPGMVAGMLLHCKSLRRFEHSGGWIKALLEEAENERMHLMTFMEVAKPKWYE

>Glyma05g24460|Glyma05g24460.1

SNVSIDLTKHHVPKNFLDKVAYRTVKLLRIPTDLFFKRRYGCRAMMLETVAAVPGMVGGM

in this output file (change original names to numbers in ascending order, starting with 1):

>1

MMLETVAAVPGMVAGMLLHCKSLRRFEHSGGWIKALLEEAENERMHLMTFMEVAKPKWYE

>2

SNVSIDLTKHHVPKNFLDKVAYRTVKLLRIPTDLFFKRRYGCRAMMLETVAAVPGMVGGM

I'm so grateful for helping. Regards, Naka

Comment on rename FASTA
Re: rename FASTA
by toolic (Chancellor) on Sep 19, 2012 at 14:45 UTC
    I have never made a script in my life.
    If you are interested in writing your own script, read perlintro and give it a try. If you have problems, post back here, showing your code and asking specific questions. See also Writeup Formatting Tips
Re: rename FASTA
by Cristoforo (Deacon) on Sep 19, 2012 at 22:10 UTC
    Using Bio::SeqIO, you can do something like this:
    #!/usr/bin/perl use strict; use warnings; use Bio::SeqIO; my $in = Bio::SeqIO->new( -file => "fasta_junk.txt" , -format => 'fasta'); my $out = Bio::SeqIO->new( -file => '>o33.txt',#note the leading '>' -format => 'fasta'); my $i; while ( my $seq = $in->next_seq() ) { $seq->display_id(++$i); # set 'id' equal to 1, 2, ... $out->write_seq($seq); } __END__ *** fasta_junk.txt >GJKKTUG01DYDGC GGGTATTCCTTCTCCACCTTGCAGCTAACATCAGTGTTTCGTCTACTCAAGCACGCCAAC ACGCCCTAGAGCGCCCTGTCCAGGGGATGGCAACCAACTCTGACCCTGCAAGTGCAGCAG ACATGAGGAATACAAACTACAATCTTTTACTTGATGATGCAATGCCGGACAAACTCTAGA >F0Z7V0F01EDB3V AAGGCGAGNGGTATCACGCAGTAAGTTACGGTTTTCGGGTAACGCGTCNGNGGNACTAAC CCACGGNGGGTAACCCGTCNCTACCGGTATAGGACTAAGGTTACCGGAACGTCGTGGGGT ACCCCCCGGACGGGGACCGTCCCCTCATANAGTCAACNGTNTGAGATGGACTAACTCAAA CCTAGTTTCAAGTACTATTTAACTTACTTACGTTACCCGTAATTTCGGCGTTTAGAGGCG *** o33.txt >1 GGGTATTCCTTCTCCACCTTGCAGCTAACATCAGTGTTTCGTCTACTCAAGCACGCCAAC ACGCCCTAGAGCGCCCTGTCCAGGGGATGGCAACCAACTCTGACCCTGCAAGTGCAGCAG ACATGAGGAATACAAACTACAATCTTTTACTTGATGATGCAATGCCGGACAAACTCTAGA >2 AAGGCGAGNGGTATCACGCAGTAAGTTACGGTTTTCGGGTAACGCGTCNGNGGNACTAAC CCACGGNGGGTAACCCGTCNCTACCGGTATAGGACTAAGGTTACCGGAACGTCGTGGGGT ACCCCCCGGACGGGGACCGTCCCCTCATANAGTCAACNGTNTGAGATGGACTAACTCAAA CCTAGTTTCAAGTACTATTTAACTTACTTACGTTACCCGTAATTTCGGCGTTTAGAGGCG
      Thank you very much. I'll try to lerning perl language. Regards

Log In?
Username:
Password:

What's my password?
Create A New User
Node Status?
node history
Node Type: perlquestion [id://994470]
Approved by toolic
help
Chatterbox?
and the web crawler heard nothing...

How do I use this? | Other CB clients
Other Users?
Others making s'mores by the fire in the courtyard of the Monastery: (13)
As of 2014-12-29 16:03 GMT
Sections?
Information?
Find Nodes?
Leftovers?
    Voting Booth?

    Is guessing a good strategy for surviving in the IT business?





    Results (193 votes), past polls