Beefy Boxes and Bandwidth Generously Provided by pair Networks
Perl Monk, Perl Meditation
 
PerlMonks  

Comment on

( #3333=superdoc: print w/ replies, xml ) Need Help??

Hi serafinososi,

...If the line starts with > (it is the first line of a FASTA file) the line is not considered...

What if the line that starts with ">" is more than one in the file what happens?

If I understand the OP's question, using the data provided, if I may suggest (adding to what others have said) using perl function split may do like so:

use warnings; use strict; my $protein; while (<DATA>) { if (/^>/) { next; } else { $protein = join '', split; } } my $number_of_F = grep { /F/ } split //, $protein; print "The aminoacid sequence: ", $protein, " contains ", $number_of_F +, " Phenylalanine aminoacids", $/; __DATA__ >gi|403369491|gb|EJY84591.1| Transcriptional regulator, Sir2 family pr +otein Oxytricha trifallax MMKQLIKHNKNTPLFNFLRVKFSSTAATIQTQQTVNKPIESKFKEEKLDNYHDIYEKSKRLAEQISQSKS + FICFTGAGLSTSTGIPDYRSTSNTLAQTGAGAYELEISEEDKKSKTRQIRSQVQRAKPSISHMALHAL +ME NGYLKHLISQNTDGLHLKSGIPYQNLTELHGNTTVEYCKSCSKIYFRDFRCRSSEDPYHHLTGRQC +EDLK CGGELADEIVHFGESIPKDKLVEALTAASQSDLCLTMGTSLRVKPANQIPIQTIKNKGQLAIVN +LQYTPF DEIAQIRMHSFTDQVLEIVCQELNIKIPEYQMKRRIHIIRNAETNEIVVYGSYGNHKNIKLS +FMQRMEYI DNKNHVYLALDKEPFHIIPDYFNFQNINTDQEEVEFRIHFYGHNSEPYFQLTLPRQSILE +LQAGEHLICD ITFDYDKLEWK

If you tell me, I'll forget.
If you show me, I'll remember.
if you involve me, I'll understand.
--- Author unknown to me

In reply to Re: PROTEIN FILE help me pleaseee by 2teez
in thread PROTEIN FILE help me pleaseee by serafinososi

Title:
Use:  <p> text here (a paragraph) </p>
and:  <code> code here </code>
to format your post; it's "PerlMonks-approved HTML":



  • Posts are HTML formatted. Put <p> </p> tags around your paragraphs. Put <code> </code> tags around your code and data!
  • Read Where should I post X? if you're not absolutely sure you're posting in the right place.
  • Please read these before you post! —
  • Posts may use any of the Perl Monks Approved HTML tags:
    a, abbr, b, big, blockquote, br, caption, center, col, colgroup, dd, del, div, dl, dt, em, font, h1, h2, h3, h4, h5, h6, hr, i, ins, li, ol, p, pre, readmore, small, span, spoiler, strike, strong, sub, sup, table, tbody, td, tfoot, th, thead, tr, tt, u, ul, wbr
  • Outside of code tags, you may need to use entities for some characters:
            For:     Use:
    & &amp;
    < &lt;
    > &gt;
    [ &#91;
    ] &#93;
  • Link using PerlMonks shortcuts! What shortcuts can I use for linking?
  • See Writeup Formatting Tips and other pages linked from there for more info.
  • Log In?
    Username:
    Password:

    What's my password?
    Create A New User
    Chatterbox?
    and the web crawler heard nothing...

    How do I use this? | Other CB clients
    Other Users?
    Others romping around the Monastery: (7)
    As of 2014-10-02 09:27 GMT
    Sections?
    Information?
    Find Nodes?
    Leftovers?
      Voting Booth?

      What is your favourite meta-syntactic variable name?














      Results (52 votes), past polls