Beefy Boxes and Bandwidth Generously Provided by pair Networks
There's more than one way to do things

Comment on

( #3333=superdoc: print w/ replies, xml ) Need Help??

If I understand the Trypsin example (I have no knowledge of this problem domain) the following code leverages Perl's string handling to produce the results I think you are looking for in this narrow case.

use strict; use warnings; my $str = 'GVGFTVILISFKYVGFFYNVIIAWALHYFFSSFTMDLPRWIHCNNTWNSPNCSDAHASN +SSDGLGLNDTFGTTPAAEYFER'; my @segments = map {[$_, (scalar tr/STY//)]} split /(?<=[KR])/, $str; printf "%45s: %d\n", @$_ for @segments;



I've no idea how the performance may compare with whatever you are doing now, but if this does anything like the task you need then I'm sure it will be an order of magnitude faster than a character at a time implementation.

True laziness is hard work

In reply to Re^2: Efficient walk/iterate along a string by GrandFather
in thread Efficient walk/iterate along a string by gje21c

Use:  <p> text here (a paragraph) </p>
and:  <code> code here </code>
to format your post; it's "PerlMonks-approved HTML":

  • Posts are HTML formatted. Put <p> </p> tags around your paragraphs. Put <code> </code> tags around your code and data!
  • Read Where should I post X? if you're not absolutely sure you're posting in the right place.
  • Please read these before you post! —
  • Posts may use any of the Perl Monks Approved HTML tags:
    a, abbr, b, big, blockquote, br, caption, center, col, colgroup, dd, del, div, dl, dt, em, font, h1, h2, h3, h4, h5, h6, hr, i, ins, li, ol, p, pre, readmore, small, span, spoiler, strike, strong, sub, sup, table, tbody, td, tfoot, th, thead, tr, tt, u, ul, wbr
  • Outside of code tags, you may need to use entities for some characters:
            For:     Use:
    & &amp;
    < &lt;
    > &gt;
    [ &#91;
    ] &#93;
  • Link using PerlMonks shortcuts! What shortcuts can I use for linking?
  • See Writeup Formatting Tips and other pages linked from there for more info.
  • Log In?

    What's my password?
    Create A New User
    and the web crawler heard nothing...

    How do I use this? | Other CB clients
    Other Users?
    Others examining the Monastery: (5)
    As of 2014-09-23 05:38 GMT
    Find Nodes?
      Voting Booth?

      How do you remember the number of days in each month?

      Results (210 votes), past polls