Beefy Boxes and Bandwidth Generously Provided by pair Networks
Your skill will accomplish
what the force of many cannot
 
PerlMonks  

Re: cleaving a sequence with specific alphabets

by prasadbabu (Prior)
on May 21, 2008 at 11:16 UTC ( #687747=note: print w/ replies, xml ) Need Help??


in reply to cleaving a sequence with specific alphabets

If I understood your question clearly, here is my solution. You can use negative look behind regex and split function to accomplsh it. TIMTOWTDI.

$string = 'APADPKGSTIDRPDAARTLTVHKCEQTDTRGVKEGTRNEDPQAECKPVSDVEFTITKLN +VD'; @arr = split /(?<!P)(K|R)/, $string; print @arr; output: ------- APADPKGSTIDRPDAARTLTVHKCEQTDTRGVKEGTRNEDPQAECKPVSDVEFTITKLNVD

Take a look at perlre and split function.

Prasad


Comment on Re: cleaving a sequence with specific alphabets
Download Code

Log In?
Username:
Password:

What's my password?
Create A New User
Node Status?
node history
Node Type: note [id://687747]
help
Chatterbox?
and the web crawler heard nothing...

How do I use this? | Other CB clients
Other Users?
Others romping around the Monastery: (10)
As of 2014-07-31 20:48 GMT
Sections?
Information?
Find Nodes?
Leftovers?
    Voting Booth?

    My favorite superfluous repetitious redundant duplicative phrase is:









    Results (253 votes), past polls