Beefy Boxes and Bandwidth Generously Provided by pair Networks
Your skill will accomplish
what the force of many cannot
 
PerlMonks  

Re: PROTEIN FILE help me pleaseee

by 2teez (Priest)
on Jan 30, 2013 at 14:58 UTC ( #1016073=note: print w/ replies, xml ) Need Help??


in reply to PROTEIN FILE help me pleaseee

Hi serafinososi,

...If the line starts with > (it is the first line of a FASTA file) the line is not considered...

What if the line that starts with ">" is more than one in the file what happens?

If I understand the OP's question, using the data provided, if I may suggest (adding to what others have said) using perl function split may do like so:

use warnings; use strict; my $protein; while (<DATA>) { if (/^>/) { next; } else { $protein = join '', split; } } my $number_of_F = grep { /F/ } split //, $protein; print "The aminoacid sequence: ", $protein, " contains ", $number_of_F +, " Phenylalanine aminoacids", $/; __DATA__ >gi|403369491|gb|EJY84591.1| Transcriptional regulator, Sir2 family pr +otein Oxytricha trifallax MMKQLIKHNKNTPLFNFLRVKFSSTAATIQTQQTVNKPIESKFKEEKLDNYHDIYEKSKRLAEQISQSKS + FICFTGAGLSTSTGIPDYRSTSNTLAQTGAGAYELEISEEDKKSKTRQIRSQVQRAKPSISHMALHAL +ME NGYLKHLISQNTDGLHLKSGIPYQNLTELHGNTTVEYCKSCSKIYFRDFRCRSSEDPYHHLTGRQC +EDLK CGGELADEIVHFGESIPKDKLVEALTAASQSDLCLTMGTSLRVKPANQIPIQTIKNKGQLAIVN +LQYTPF DEIAQIRMHSFTDQVLEIVCQELNIKIPEYQMKRRIHIIRNAETNEIVVYGSYGNHKNIKLS +FMQRMEYI DNKNHVYLALDKEPFHIIPDYFNFQNINTDQEEVEFRIHFYGHNSEPYFQLTLPRQSILE +LQAGEHLICD ITFDYDKLEWK

If you tell me, I'll forget.
If you show me, I'll remember.
if you involve me, I'll understand.
--- Author unknown to me


Comment on Re: PROTEIN FILE help me pleaseee
Download Code

Log In?
Username:
Password:

What's my password?
Create A New User
Node Status?
node history
Node Type: note [id://1016073]
help
Chatterbox?
and the web crawler heard nothing...

How do I use this? | Other CB clients
Other Users?
Others browsing the Monastery: (12)
As of 2014-09-18 20:09 GMT
Sections?
Information?
Find Nodes?
Leftovers?
    Voting Booth?

    How do you remember the number of days in each month?











    Results (124 votes), past polls