Beefy Boxes and Bandwidth Generously Provided by pair Networks
Pathologically Eclectic Rubbish Lister
 
PerlMonks  

Re: file header change

by Kenosis (Priest)
on Feb 05, 2013 at 15:26 UTC ( #1017205=note: print w/ replies, xml ) Need Help??


in reply to file header change

Try the following:

use strict; use warnings; my $i = 1; while (<>) { s/>\K.+/$i++/e; print; }

Output from your data:

>1 MNLTFDYTKEPSRDVLCIDVKSFYASVECVERG LDPLKTMLVVMSNSENSGGLVLAASPM >2 MKQNRKEFSSYFSRSIKQNKPLYLLLMSSETNPF PRPVIGTFRGYVEENKIIIGEDSYSI

Usage: perl script.pl inFile >outFile

As the fasta inFile is read line-by-line, the regex will substitute all past the > with the value of $i. The >outFile notation directs the printing to the file outFile.

Hope this helps!


Comment on Re: file header change
Select or Download Code
Re^2: file header change
by utpalmtbi (Acolyte) on Feb 05, 2013 at 16:36 UTC
    it works.. thank u very much..

      You're most welcome, utpalmtbi!

Log In?
Username:
Password:

What's my password?
Create A New User
Node Status?
node history
Node Type: note [id://1017205]
help
Chatterbox?
and the web crawler heard nothing...

How do I use this? | Other CB clients
Other Users?
Others meditating upon the Monastery: (4)
As of 2015-07-05 10:39 GMT
Sections?
Information?
Find Nodes?
Leftovers?
    Voting Booth?

    The top three priorities of my open tasks are (in descending order of likelihood to be worked on) ...









    Results (61 votes), past polls