Beefy Boxes and Bandwidth Generously Provided by pair Networks
Don't ask to ask, just ask
 
PerlMonks  

Re: file header change

by Kenosis (Priest)
on Feb 05, 2013 at 15:26 UTC ( #1017205=note: print w/replies, xml ) Need Help??


in reply to file header change

Try the following:

use strict; use warnings; my $i = 1; while (<>) { s/>\K.+/$i++/e; print; }

Output from your data:

>1 MNLTFDYTKEPSRDVLCIDVKSFYASVECVERG LDPLKTMLVVMSNSENSGGLVLAASPM >2 MKQNRKEFSSYFSRSIKQNKPLYLLLMSSETNPF PRPVIGTFRGYVEENKIIIGEDSYSI

Usage: perl script.pl inFile >outFile

As the fasta inFile is read line-by-line, the regex will substitute all past the > with the value of $i. The >outFile notation directs the printing to the file outFile.

Hope this helps!

Replies are listed 'Best First'.
Re^2: file header change
by utpalmtbi (Acolyte) on Feb 05, 2013 at 16:36 UTC
    it works.. thank u very much..

      You're most welcome, utpalmtbi!

Log In?
Username:
Password:

What's my password?
Create A New User
Node Status?
node history
Node Type: note [id://1017205]
help
Chatterbox?
and the web crawler heard nothing...

How do I use this? | Other CB clients
Other Users?
Others musing on the Monastery: (5)
As of 2016-10-01 22:24 GMT
Sections?
Information?
Find Nodes?
Leftovers?
    Voting Booth?
    How many different varieties (color, size, etc) of socks do you have in your sock drawer?






    Results (9 votes). Check out past polls.