|
|
|
Clear questions and runnable code get the best and fastest answer |
|
| PerlMonks |
rename FASTAby naka (Initiate) |
| on Sep 19, 2012 at 14:39 UTC ( #994470=perlquestion: print w/ replies, xml ) | Need Help?? |
|
naka has asked for the
wisdom of the Perl Monks concerning the following question:
Hello,
I have never made a script in my life. The ploblem is how to change the fasta names like this input file: >Glyma04g14800|Glyma04g14800.3 MMLETVAAVPGMVAGMLLHCKSLRRFEHSGGWIKALLEEAENERMHLMTFMEVAKPKWYE >Glyma05g24460|Glyma05g24460.1 SNVSIDLTKHHVPKNFLDKVAYRTVKLLRIPTDLFFKRRYGCRAMMLETVAAVPGMVGGM in this output file (change original names to numbers in ascending order, starting with 1): >1 MMLETVAAVPGMVAGMLLHCKSLRRFEHSGGWIKALLEEAENERMHLMTFMEVAKPKWYE >2 SNVSIDLTKHHVPKNFLDKVAYRTVKLLRIPTDLFFKRRYGCRAMMLETVAAVPGMVGGM I'm so grateful for helping. Regards, Naka
Back to
Seekers of Perl Wisdom
|
|
||||||||||||||||||||||||||