Beefy Boxes and Bandwidth Generously Provided by pair Networks
Perl-Sensitive Sunglasses
 
PerlMonks  

Re: Problem computing GC content

by Kenosis (Priest)
on Jul 14, 2014 at 17:03 UTC ( #1093586=note: print w/replies, xml ) Need Help??

Help for this page

Select Code to Download


  1. or download this
    use strict;
    use warnings;
    ...
        my $GCcount = $seq =~ tr/GC//;
        printf "%s, %.2f%%\n", ">$id", ( $GCcount / length $seq ) * 100;
    }
    
  2. or download this
    >gi|5524211|gb|AAD44166.1| cytochrome b [Elephas maximus maximus]
    LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV
    ...
    LLILILLLLLLALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVIL
    GLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGX
    IENY
    
  3. or download this
    >gi|5524211|gb|AAD44166.1| cytochrome b [Elephas maximus maximus], 7.3
    +9%
    

Log In?
Username:
Password:

What's my password?
Create A New User
Domain Nodelet?
Node Status?
node history
Node Type: note [id://1093586]
help
Chatterbox?
and the web crawler heard nothing...

How do I use this? | Other CB clients
Other Users?
Others pondering the Monastery: (5)
As of 2021-10-19 15:54 GMT
Sections?
Information?
Find Nodes?
Leftovers?
    Voting Booth?
    My first memorable Perl project was:







    Results (77 votes). Check out past polls.

    Notices?