Beefy Boxes and Bandwidth Generously Provided by pair Networks
good chemistry is complicated,
and a little bit messy -LW
 
PerlMonks  

Re^3: Count the sequence length of each entry in the file (updated)

by AnomalousMonk (Bishop)
on Oct 03, 2020 at 07:28 UTC ( #11122507=note: print w/replies, xml ) Need Help??


in reply to Re^2: Count the sequence length of each entry in the file
in thread Count the sequence length of each entry in the file

Actually, the input file is ... [update: quoted from this post]

Rather than saying (update: in a different post!) what your example data actually is, why not post that data as it actually is, in a form immediately usable by other monks (who are trying to help you). That is, use <code> ... </code> tags to post your data, maybe something like:

<code> >sp_0005_SySynthetic ConstructTumor protein p53 N-terminal transcripti +on-activation domain VQLQESGGGLVQAGGSLRLSCAASGRAVSMYNMGWFRQAPGQERELVAAISRGGSIYYA DSVKGRFTISRDNAKNTLYLQMNNLKPEDTGVYQCRQGSTLGQGTQVTVSS >sp_0017_CaCamelidSorghum bicolor multidrug and toxic compound extrusi +on sbmate HVQLVESGGGSVQAGGSLRLTCAASGFTFSNYYMSWVRQAPGKGLEWVSSIYSVGSNGYY ADSVKGRSTISRDNAKNTLYLQMNSLKPEDTAVYYCAAEPGGSWWDAYSYWGQGTQVTVS S </code>
In addition to being your exact example data, this data is easily [download]-able by anyone who might want to help with this problem. You might want to add this <code>-tagged example data as an update (see How do I change/delete my post?) to your original post in addition to finally updating this post, or at the very least update this post and add to the OP a note saying that example data can be found there.

Please see Markup in the Monastery, Writeup Formatting Tips and What shortcuts can I use for linking to other information?, and perhaps some of the articles in the Understanding and Using PerlMonks section of the Monastery's Tutorials.

Update: Some trivial wording changes; added links to actual "Actually..." post.


Give a man a fish:  <%-{-{-{-<

Log In?
Username:
Password:

What's my password?
Create A New User
Node Status?
node history
Node Type: note [id://11122507]
help
Chatterbox?
and the web crawler heard nothing...

How do I use this? | Other CB clients
Other Users?
Others chilling in the Monastery: (3)
As of 2020-11-30 08:52 GMT
Sections?
Information?
Find Nodes?
Leftovers?
    Voting Booth?

    No recent polls found

    Notices?