Beefy Boxes and Bandwidth Generously Provided by pair Networks
Perl Monk, Perl Meditation
 
PerlMonks  

How to make unique entries

by Anonymous Monk
on Jun 01, 2023 at 23:13 UTC ( [id://11152595]=perlquestion: print w/replies, xml ) Need Help??

Help for this page

Select Code to Download


  1. or download this
    >id_1|id_2
    sequence_of_chars
    label_of_chars
    
  2. or download this
    >4kt0_M|P72986
    MALSDTQILAALVVALLPAFLAFRLSTELYK
    ...
    >6hqb_M|P72986
    MALSDTQILAALVVALLPAFLAFRLSTELYK
    iiiiiiiiiiiMMMMMMMMMMMMMMIIIIII
    

Log In?
Username:
Password:

What's my password?
Create A New User
Domain Nodelet?
Node Status?
node history
Node Type: perlquestion [id://11152595]
Approved by kcott
help
Chatterbox?
and the web crawler heard nothing...

How do I use this?Last hourOther CB clients
Other Users?
Others having a coffee break in the Monastery: (4)
As of 2024-04-15 16:51 GMT
Sections?
Information?
Find Nodes?
Leftovers?
    Voting Booth?

    No recent polls found