Re: Bioinformatics: Regex loop, no output

in reply to Bioinformatics: Regex loop, no output

Maybe like this?

use strict;
use warnings;
use Data::Dumper;

my @proteins=qw(
DAAAAATTLTTTAMTTTTTTCKMMFRPPPPPGGGGGGGGGGGG 
ALTAMCMNVWEITYHKGSDVNRRASFAQPPPQPPPPLLAIKPASDASD
);
print Dumper \@proteins;
my @new_peptides;

for my $protein (@proteins) {
    if ($protein =~ m/[K(?!P)|R(?!P)]/g) {        
        $protein =~ s/K(?!P)|R(?!P)/=/g;
        push @new_peptides, split ('=',$protein);        
    }
}
print Dumper \@new_peptides;
for (@new_peptides) {
    print "The peptide is $_\n";
}
[download]

I use Data::Dumper all the time because I've been fooled by my data too many times. ;-)

In Section Seekers of Perl Wisdom