Beefy Boxes and Bandwidth Generously Provided by pair Networks
Syntactic Confectionery Delight

REGEX help

by Mike98mm (Initiate)
on Apr 20, 2018 at 19:51 UTC ( #1213294=perlquestion: print w/replies, xml ) Need Help??

Mike98mm has asked for the wisdom of the Perl Monks concerning the following question:

I am new to perl.

I am trying to write a simple code to find an ORF (open reading frames)

I am trying to identify the ORF with start(ATG) and stop codons(TAA|TAG|TGA) and print out the ORF.

The nucleotide sequence:


2018-05-02 Athanasius added code and paragraph tags

Replies are listed 'Best First'.
Re: REGEX help
by tybalt89 (Parson) on Apr 20, 2018 at 21:00 UTC
Re: REGEX help
by dorko (Prior) on Apr 20, 2018 at 21:31 UTC
    Hello. Welcome.

    I think you want to look at BioPerl.

    This code is completely untested. I didn't want to install BioPerl on my system. But it might work if you can get BioPerl installed. (I know you're new to Perl, so installing BioPerl might be a stretch, but this might help:

    #!/bin/perl use strict; use warnings; use Bio::Seq; use Data::Dumper::Simple; use feature "say"; # Convert the sequence to lower case. Upper Case might be ok, # but the docs for Bio::Seq used lower case, so let's go with that. my $letters = lc("TTCAGGTGTTTGCAACTGCGTTTTATTGCAAGAAAGAGTGGAGGGGTTTCCA +TGGGGCCCACCTCACAACCCACTC TTCACCCCCAAAATCACGCAGGGATCGGACTCAGGAAAGGGAAG +CATCTGTGTGTTGCATACGAGCCCTTCCTGTACTTACTTCTTTCACAGCAGGGAAGG AAGAGGGAAGA +GGCAGCTGTGGAGAGGATCAGGTTGCGGGAGGTGGGTATCTCGCTGCTCTGACCTTACGTACAGTCCTC +CACAGAAGCATCAAAGTGGACT GGCACATATCGGCTCCCTTCACAGGCCACAATCATCTGTCTCTCCT +TCGGGCTGGTCCGGTATCCAC"); #Create a sequence object. my $seq_object = Bio::Seq->new(-seq => $letters, -alphabet => 'dna' ); #Look for the ORF. I specified the start, but I didn't see how to #specify the stop. Are the stop codons universal? I'm way out of #my league here. $prot_object = $seq_object->translate( -orf => 1, -start => "atg" ); say Dumper $prot_object;



    -- Yeah, I'm a Delt.

      One must be the volunteer. So i forced a cpanm install and only added a my you forgot. Unfortunately the script crashed the hard way:

      ------------- EXCEPTION ------------- MSG: Failed validation of sequence '[unidentified sequence]'. Invalid +characters were: STACK Bio::PrimarySeq::validate_seq /Users/karl/perl5/perlbrew/perls/p +erl-5.24.1threads/lib/site_perl/5.24.1/Bio/ STACK Bio::PrimarySeq::_set_seq_by_ref /Users/karl/perl5/perlbrew/perl +s/perl-5.24.1threads/lib/site_perl/5.24.1/Bio/ STACK Bio::PrimarySeq::seq /Users/karl/perl5/perlbrew/perls/perl-5.24. +1threads/lib/site_perl/5.24.1/Bio/ STACK Bio::PrimarySeq::new /Users/karl/perl5/perlbrew/perls/perl-5.24. +1threads/lib/site_perl/5.24.1/Bio/ STACK Bio::Seq::new /Users/karl/perl5/perlbrew/perls/perl-5.24.1thread +s/lib/site_perl/5.24.1/Bio/ STACK toplevel ./ -------------------------------------

      Just for curiosity. Anyway - too bad. This stuff is PITA...

      Best regards, Karl

      «The Crux of the Biscuit is the Apostrophe»

      perl -MCrypt::CBC -E 'say Crypt::CBC->new(-key=>'kgb',-cipher=>"Blowfish")->decrypt_hex($ENV{KARL});'Help

        Take the spaces out of $letters and you should get

        $prot_object = bless( { 'primary_seq' => bless( { 'length' => 63, '_root_verbose' => 0 +, '_nowarnonempty' => +undef, 'seq' => 'MGPTSQPTLH +PQNHAGIGLRKGKHLCVAYEPFLYLLLSQQGRKREEAAVERIRLREVGISLL*', 'alphabet' => 'prote +in' }, 'Bio::PrimarySeq' ) +, '_root_verbose' => 0 }, 'Bio::Seq' );

        whatever that means !

Re: REGEX help
by Cristoforo (Curate) on Apr 20, 2018 at 21:06 UTC
Re: REGEX help
by LeBreton (Initiate) on Apr 21, 2018 at 11:19 UTC
    Hi Mike, You can look at the High Order Perl book or the article "How Perl save the DNA Project" (or something like that. You'll find all what you want i think.

      Free download of Dominus's "Higher-Order Perl" here.

      Give a man a fish:  <%-{-{-{-<

Log In?

What's my password?
Create A New User
Node Status?
node history
Node Type: perlquestion [id://1213294]
Approved by Corion
and the web crawler heard nothing...

How do I use this? | Other CB clients
Other Users?
Others scrutinizing the Monastery: (4)
As of 2020-07-04 22:58 GMT
Find Nodes?
    Voting Booth?

    No recent polls found
