Hi serafinososi,
...If the line starts with “>” (it is the first line of a FASTA file) the line is not considered...
What if the line that starts with ">" is more than one in the file what happens?
If I understand the OP's question, using the data provided, if I may suggest (adding to what others have said) using perl function split may do like so:
use warnings;
use strict;
my $protein;
while (<DATA>) {
if (/^>/) {
next;
}
else {
$protein = join '', split;
}
}
my $number_of_F = grep { /F/ } split //, $protein;
print "The aminoacid sequence: ", $protein, " contains ", $number_of_F
+,
" Phenylalanine aminoacids", $/;
__DATA__
>gi|403369491|gb|EJY84591.1| Transcriptional regulator, Sir2 family pr
+otein Oxytricha trifallax
MMKQLIKHNKNTPLFNFLRVKFSSTAATIQTQQTVNKPIESKFKEEKLDNYHDIYEKSKRLAEQISQSKS
+ FICFTGAGLSTSTGIPDYRSTSNTLAQTGAGAYELEISEEDKKSKTRQIRSQVQRAKPSISHMALHAL
+ME NGYLKHLISQNTDGLHLKSGIPYQNLTELHGNTTVEYCKSCSKIYFRDFRCRSSEDPYHHLTGRQC
+EDLK CGGELADEIVHFGESIPKDKLVEALTAASQSDLCLTMGTSLRVKPANQIPIQTIKNKGQLAIVN
+LQYTPF DEIAQIRMHSFTDQVLEIVCQELNIKIPEYQMKRRIHIIRNAETNEIVVYGSYGNHKNIKLS
+FMQRMEYI DNKNHVYLALDKEPFHIIPDYFNFQNINTDQEEVEFRIHFYGHNSEPYFQLTLPRQSILE
+LQAGEHLICD ITFDYDKLEWK
If you tell me, I'll forget.
If you show me, I'll remember.
if you involve me, I'll understand.
--- Author unknown to me
-
Are you posting in the right place? Check out Where do I post X? to know for sure.
-
Posts may use any of the Perl Monks Approved HTML tags. Currently these include the following:
<code> <a> <b> <big>
<blockquote> <br /> <dd>
<dl> <dt> <em> <font>
<h1> <h2> <h3> <h4>
<h5> <h6> <hr /> <i>
<li> <nbsp> <ol> <p>
<small> <strike> <strong>
<sub> <sup> <table>
<td> <th> <tr> <tt>
<u> <ul>
-
Snippets of code should be wrapped in
<code> tags not
<pre> tags. In fact, <pre>
tags should generally be avoided. If they must
be used, extreme care should be
taken to ensure that their contents do not
have long lines (<70 chars), in order to prevent
horizontal scrolling (and possible janitor
intervention).
-
Want more info? How to link
or How to display code and escape characters
are good places to start.
|