my $file = '/home/guest/sampir.txt');
open (PIR, '<', $file) or die "Can't read '$file': $!\n";
my @arr = ();
my $se = [];             # anonymous record array
while(<PIR>)
{
    chomp;
    if (/^(\w+)\s+/)     # new field identifier, followed by blanks
    {
        push @$se, $_; 
    }
    elsif (s/^\s+/ /)    # if we can strip leading blanks,
                         # it's a continuation line
    {
        $se->[-1] .= $_; # append to last field of this record
    }
    elsif(/^\w+$/)       # must be the last field of the record
    {
        push @$se, $_;   # save the last field
        push @arr, $se;  # save the record array reference
        $se = [];        # and make a new array reference for the next record
    }
    else
    {
        die "Unknown line type at line $. of '$file'\n";
    }
}

##</code><code>##

@arr = (
  [
    'ENTRY            CCHU       #type complete',
    'TITLE            cytochrome c [validated] - human Homo sapiens',
    'ORGANISM         #formal_name Homo sapiens #common_name man',
    'ACCESSIONS       A31764; A05676; I55192; A00001',
    'MGDVEKGKKIFIMKCSQCHTVEMGDVEKGGKHKTGPNLHGMIYARAJLFGRKTSEKGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIP'
  ],
  [
    'ENTRY            CCCZ       #type complete',
    'TITLE            cytochrome c - chimpanzee (tentative sequence)',
    'ORGANISM         #formal_name Pan troglodytes #common_name chimpanzee',
    'ACCESSIONS       A00002',
    'GDVEKGKKIFIMKCSQCHTSEKVEKGSSSKHKSSSTGPNLHGLMIYARAJFGRKTGSEKQAPGYSYTAANKNKGIIWGED'
  ],
  [
    'ENTRY            CCMQR      #type complete',
    'TITLE            cytochrome c - rhesus macaque (tentative sequence) Macaca mulatta ',
    'ORGANISM         #formal_name Macaca mulatta #common_name rhesus macaque',
    'ACCESSIONS       A00003',
    'GDVEKGKKIFIMKCSQSEKCHTVEKGGSSSSKHKTGPNLHGSSEKEMIYARAJKSEKLFGAAAAAAAARKTGQAPGYSYTAANKSSSSNKGITWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEE'
  ],
  [
    'ENTRY            CCMKP      #type complete',
    'TITLE            cytochrome c - spider monkey',
    'ORGANISM         #formal_name Ateles sp. #common_name spider monkey',
    'ACCESSIONS       A00004',
    'GDVFKGKRIFIMKCSQCHTVESSSSKGGKHKTGPNLHGLMIYARAJSEKFGSSSSSSSSSSR'
  ]
);

##</code><code>##

print $arr[0]->[1],"\n";

##</code><code>##

TITLE            cytochrome c [validated] - human Homo sapiens