heidi has asked for the wisdom of the Perl Monks concerning the following question:
hi all,
I have a sequence like this :
I want to cleave this sequence at the regions of "K" (or) "R" but they should not be present before "P". when i split it with either K or R, the K and R alphabet disappears. So, how do i split and also retain the alphabet? Finally, the list of fragments should be stored in an array. pls help. thanks :)APADPKGSTIDRPDAARTLTVHKCEQTDTRGVKEGTRNEDPQAECKPVSDVEFTITKLNVD
|
---|
Replies are listed 'Best First'. | |
---|---|
Re: cleaving a sequence with specific alphabets
by mwah (Hermit) on May 21, 2008 at 11:09 UTC | |
by tachyon-II (Chaplain) on May 21, 2008 at 11:31 UTC | |
by mwah (Hermit) on May 21, 2008 at 12:10 UTC | |
by tachyon-II (Chaplain) on May 21, 2008 at 16:30 UTC | |
by ikegami (Patriarch) on May 21, 2008 at 17:00 UTC | |
| |
Re: cleaving a sequence with specific alphabets
by grizzley (Chaplain) on May 21, 2008 at 11:07 UTC | |
Re: cleaving a sequence with specific alphabets
by BrowserUk (Patriarch) on May 21, 2008 at 11:21 UTC | |
Re: cleaving a sequence with specific alphabets
by prasadbabu (Prior) on May 21, 2008 at 11:16 UTC |
Back to
Seekers of Perl Wisdom