Beefy Boxes and Bandwidth Generously Provided by pair Networks
Pathologically Eclectic Rubbish Lister
 
PerlMonks  

Re^2: remove part of string (DNA)

by Generoso (Prior)
on Apr 12, 2011 at 16:17 UTC ( #898989=note: print w/replies, xml ) Need Help??

Help for this page

Select Code to Download


  1. or download this
    #!/usr/bin/perl
    #
    ...
    ASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPK
    NMYKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGR
    KSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARRELVISLIVES
    
  2. or download this
    perl "D:\Citi Midleware\db\perl\perl5data.pl" stocks 10 5
    Process started >>>
    ...
    
    <<< Process finished.
    ================ READY ================
    

Log In?
Username:
Password:

What's my password?
Create A New User
Domain Nodelet?
Node Status?
node history
Node Type: note [id://898989]
help
Chatterbox?
and the web crawler heard nothing...

How do I use this? | Other CB clients
Other Users?
Others avoiding work at the Monastery: (2)
As of 2022-05-19 06:19 GMT
Sections?
Information?
Find Nodes?
Leftovers?
    Voting Booth?
    Do you prefer to work remotely?



    Results (71 votes). Check out past polls.

    Notices?